LOADING...
   ZP_02032405.1;SP13677A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02032405.1 Chemical properties of protein sequence with tag

Accession: ZP_02032405.1
Description: gi|154492779|ref|ZP_02032405.1| hypothetical protein PARMER_02418 [Parabacteroides merdae ATCC 43184]
Organism: Parabacteroides merdae
  No Tag Tag
Residues(aa) 304 316
Molecular Weight (Dalton) 34425.17 35879.72
Isoelectric Point 7.75 7.81
Extinction Coefficient 59360 59360
Gravy -.5 -0.55
Number of Met 5 6
%Met 1.64 1.90
Number of Cys 3 3
%Cys 0.99 0.95
SEQUENCE  amino acids 316 aa; containing Tag mgsdkihhhhhh
>ZP_02032405.1 gi|154492779|ref|ZP_02032405.1| hypothetical protein PARMER_02418 [Parabacteroides merdae ATCC 43184]
mgsdkihhhhhhMRHLHFGKLFFVVFSLLLAYTVSARKPIKTLLITGQNNHNWQVSHVVL
KQILENSGRFDVDFVISPEQGKDMSGFVLDFSPYQLVVLDYNGDSWPEETNRRFLEYVQN
GGGVVIYHAADNAFSKWPEFNRICALGGWEGRNENSGPYVYWKDGKLVKDSSAGPGGSHG
RQHEYVLNGRDKVHPVVKGLPLKWRHAKDELYDRMRGPGNIRDILYTAYSDKETNGSGRE
EPLVFTVDYGNARIFHTMLGHAGATTEDNIAMQCTGFQVLLLRGAEWAATGKVTQKVPKD
FPTETTCSYRKDYKEN

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu