LOADING...
   ZP_02030716.1;SP16962B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02030716.1 Chemical properties of protein sequence with tag

Accession: ZP_02030716.1
Description: gi|154490775|ref|ZP_02030716.1| hypothetical protein PARMER_00689 [Parabacteroides merdae ATCC 43184]
Organism: Parabacteroides merdae
  No Tag Tag
Residues(aa) 256 268
Molecular Weight (Dalton) 29043.79 30498.34
Isoelectric Point 8.69 8.69
Extinction Coefficient 40910 40910
Gravy -.38 -0.44
Number of Met 7 8
%Met 2.73 2.99
Number of Cys 5 5
%Cys 1.95 1.87
SEQUENCE  amino acids 268 aa; containing Tag mgsdkihhhhhh
>ZP_02030716.1 gi|154490775|ref|ZP_02030716.1| hypothetical protein PARMER_00689 [Parabacteroides merdae ATCC 43184]
mgsdkihhhhhhMKNSRRDFLKKGALAGFSALMIPEIAKAAVKENTSVHAPKINLKKDCV
ILFQGDSITDCGRDRNSNRCNTMEQFGSGYVLFTATQLLEGKAALQPKIYNRGISGNKVY
QLRERWEIDCLAFQPDVLSILIGVNDYWHTLTHGYKGTVETYENDLRALLKYTKEKLPNT
QIVLCEPFTLRDGAAIEDSKWYPMFDEFRKSARKLSEEFNTIFVPFQSGFDAAVKLAPAR
YWSNDGVHPDLPGRQLMANMWMEATGLK

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu