LOADING...
   ZP_02030627.1;SP0437A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02030627.1 Chemical properties of protein sequence with tag

Accession: ZP_02030627.1
Description: gi|154490366|ref|ZP_02030627.1| hypothetical protein PARMER_00599 [Parabacteroides merdae ATCC 43184]
Organism: Parabacteroides merdae
  No Tag Tag
Residues(aa) 250 262
Molecular Weight (Dalton) 26600.91 28055.46
Isoelectric Point 5.5 6.24
Extinction Coefficient 13410 13410
Gravy .06 -0.03
Number of Met 5 6
%Met 2.00 2.29
Number of Cys 7 7
%Cys 2.80 2.67
SEQUENCE  amino acids 262 aa; containing Tag mgsdkihhhhhh
>ZP_02030627.1 gi|154490366|ref|ZP_02030627.1| hypothetical protein PARMER_00599 [Parabacteroides merdae ATCC 43184]
mgsdkihhhhhhMNKNKLFASVIGLLVFVAGLSAKDYQVAMFGIKSDGVTLNTRSIQRAV
DYISEQGGGRLIFYVGRYLTGSIELKSNVTIRIEEGAVLVAVPSVYDFKGVGGCNAIIYA
DKQKNIGIGGKGIIDGRSIAVRASVEEQLQKGHIEGNVSDYAPALICMEGCEDVKIEQVT
LQDAANVAEIYKDCHNVTVDKVVVNAGASDRKAISISGCDGVKMTDCYFNMAGNPLESAG
TSRNLIFTNCITPDGKAVSSDQ

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu