LOADING...
   YP_193882.1;GD9765C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_193882.1 Chemical properties of protein sequence with tag

Accession: YP_193882.1
Description: gi|58337297|ref|YP_193882.1| putative trp repressor binding protein [Lactobacillus acidophilus NCFM]
Organism: Lactobacillus acidophilus NCFM
  No Tag Tag
Residues(aa) 150 162
Molecular Weight (Dalton) 17002.15 18456.70
Isoelectric Point 4.81 5.55
Extinction Coefficient 33920 33920
Gravy -.55 -0.64
Number of Met 4 5
%Met 2.67 3.09
Number of Cys 0 0
%Cys 0.00 0.00
SEQUENCE  amino acids 162 aa; containing Tag mgsdkihhhhhh
>YP_193882.1 gi|58337297|ref|YP_193882.1| putative trp repressor binding protein [Lactobacillus acidophilus NCFM]
mgsdkihhhhhhMAKKTLILYYSWSGETKKMAEKINSEIKDSELKEVKVSEGTFDADMYK
TSDIALDQIQGNKDFPEIQLDNIDYNNYDLILIGSPVWSGYPATPIKTLLDQMKNYRGEV
ASFFTSAGTNHKAYVSHFNEWADGLNVIGVARDDSEVDKWSK

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu