LOADING...
   YP_095136.1;SP19086A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_095136.1 Chemical properties of protein sequence with tag

Accession: YP_095136.1
Description: gi|52841337|ref|YP_095136.1| hypothetical protein lpg1103 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
Organism: LEGIONELLA PNEUMOPHILA SUBSP. PNEUMOPHILA STR. PHILADELPHIA 1
  No Tag Tag
Residues(aa) 403 415
Molecular Weight (Dalton) 45740.97 47195.52
Isoelectric Point 5.54 5.86
Extinction Coefficient 56730 56730
Gravy -.13 -0.18
Number of Met 15 16
%Met 3.72 3.86
Number of Cys 2 2
%Cys 0.50 0.48
SEQUENCE  amino acids 415 aa; containing Tag mgsdkihhhhhh
>YP_095136.1 gi|52841337|ref|YP_095136.1| hypothetical protein lpg1103 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
mgsdkihhhhhhMVMKTMRLFKGILFTFCGIIFCFNSHAALEHEKLVNYIALGEFSRETA
EIALKKMPPLDTLTVHYDLQLYKINYKTQSPDGNLTIASGLVAMPIHPVGQVGIISYQHG
TRFERNDVPSRNNEKNYIYLAAYGNSAGYMTVMPDYLGLGDNELTLHPYVQAETLASSSI
DMLFAAKELANRLHYPISDKLYLAGYSEGGFSTIVMFEMLAKEYPDLPVSAVAPGSAPYG
WEETMHFVMLEPGPRATAYLAYFFYSLQTYKSYWSGFDEIFAPPYNTLIPELMDGYHAVD
EILQALPQDPLLIFQPKFSNGIISKTDRNTEILKINFNHYDFKPTAPLLLVGTKGDRDVP
YAGAEMAYHSFRKYSDFVWIKSVSDALDHVQAHPFVLKEQVDFFKQFERQEAMNK

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu