LOADING...
   YP_094990.1;SP19432A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_094990.1 Chemical properties of protein sequence with tag

Accession: YP_094990.1
Description: gi|52841191|ref|YP_094990.1| hypothetical protein lpg0956 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
Organism: LEGIONELLA PNEUMOPHILA SUBSP. PNEUMOPHILA STR. PHILADELPHIA 1
  No Tag Tag
Residues(aa) 392 404
Molecular Weight (Dalton) 44479.19 45933.74
Isoelectric Point 7.12 7.26
Extinction Coefficient 51800 51800
Gravy -.42 -0.47
Number of Met 4 5
%Met 1.02 1.24
Number of Cys 3 3
%Cys 0.77 0.74
SEQUENCE  amino acids 404 aa; containing Tag mgsdkihhhhhh
>YP_094990.1 gi|52841191|ref|YP_094990.1| hypothetical protein lpg0956 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
mgsdkihhhhhhMKTAHLIWISAFCIAQAHAFTLPRQPTKAYECENCSQLSRENLHDKWE
ITNEPLNNNISNVRRSYGYKERISLEQLQRGVIISTLAPGAVVRITPLQNKSIPELLIKT
PKNQLLPLKEASSLYNQDDEVGNNPLAITKHQAMLQIKPELGYGKFILKSKDITNKYADA
YMISVLDKFSITYLEVETDSLHYQYGDKLKATISLHNDITEYDVNDVDARLVGPKGQVIS
LNLTKLKSNVFEGTATLDSELNDRGENWYLETDVQTEYGQEIIRRSGHTAFSYSIPSASL
MNVKKLSSKPLTFVVTVDVATASRYALQSVLFQKNGKGEARPIQTSQRAQWLEPGKHVLQ
FTFDNHNQLSDDNLYLGYLRLIDYGQLKTVYQYNQPVKLSQLVD

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu