LOADING...
   YP_001714229.1;SP2417A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001714229.1 Chemical properties of protein sequence with tag

Accession: YP_001714229.1
Description: gi|169796436|ref|YP_001714229.1| ankyrin repeat-containing protein [Acinetobacter baumannii AYE]
Organism: Acinetobacter baumannii AYE
  No Tag Tag
Residues(aa) 236 248
Molecular Weight (Dalton) 25667.25 27121.80
Isoelectric Point 8.47 8.47
Extinction Coefficient 24410 24410
Gravy .04 -0.05
Number of Met 8 9
%Met 3.39 3.63
Number of Cys 2 2
%Cys 0.85 0.81
SEQUENCE  amino acids 248 aa; containing Tag mgsdkihhhhhh
>YP_001714229.1 gi|169796436|ref|YP_001714229.1| ankyrin repeat-containing protein [Acinetobacter baumannii AYE]
mgsdkihhhhhhMPNCYAIHFYLECFMRKSLIWINLIIAMGALGFTNAVNAKDEYPLHMA
AANDDIQLIKHILSQKTLIDARDETGSTALMVATRANNIHAAHMLIEAGADVNAKDNIQD
SPYLYAGAQGYLKILRMTLMHGADLKSTNRYGGTALIPAAERGHVETVRTLIAAGVNVNH
VNNLGWTALLEAIILGNGKSNYQQIVALLLKAGANPNLADKDGITPLQHARTRGYREIEK
LLLVAGAK

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu