LOADING...
   YP_001635819.1;MI10991B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001635819.1 Chemical properties of protein sequence with tag

Accession: YP_001635819.1
Description: caur_25may01_Contig941_revised_gene4220
Organism: CHLOROFLEXUS AURANTIACUS J-10-FL
  No Tag Tag
Residues(aa) 198 210
Molecular Weight (Dalton) 21864.87 23319.42
Isoelectric Point 5.98 6.41
Extinction Coefficient 14440 14440
Gravy -.01 -0.11
Number of Met 5 6
%Met 2.53 2.86
Number of Cys 1 1
%Cys 0.51 0.48
SEQUENCE  amino acids 210 aa; containing Tag mgsdkihhhhhh
>YP_001635819.1 caur_25may01_Contig941_revised_gene4220
mgsdkihhhhhhMRKGQETRERVVAQAAALFNVSGYAGTAISDIMAATGLEKGGIYRHFE
SKEQLALAAFDYAAEKVRERFAVGLAGHKHTVDTIIAFLDVFRSYAERPPLVGGCPILNT
AIESDDTNPMLRERVRAVIDEWRETIRTLVQTGIARGEIRPEVDADRLALLIIATMEGAV
MLARILETATPLEHAYTHLATYITQQVRLA

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu