LOADING...
   YP_001337146.1;SP18574A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001337146.1 Chemical properties of protein sequence with tag

Accession: YP_001337146.1
Description: gi|152972000|ref|YP_001337146.1| hypothetical protein KPN_03484 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
Organism: Klebsiella pneumoniae subsp. pneumoniae MGH 78578
  No Tag Tag
Residues(aa) 101 113
Molecular Weight (Dalton) 11196.41 12650.96
Isoelectric Point 5.19 6.20
Extinction Coefficient 12490 12490
Gravy -.06 -0.25
Number of Met 7 8
%Met 6.93 7.08
Number of Cys 3 3
%Cys 2.97 2.65
SEQUENCE  amino acids 113 aa; containing Tag mgsdkihhhhhh
>YP_001337146.1 gi|152972000|ref|YP_001337146.1| hypothetical protein KPN_03484 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
mgsdkihhhhhhMNLPKALVLTVAATTFCLMTSPAFAVEETTPQNMTCQEFMDMNPKSMT
PVAFWVVNRNTDFSGGDYVDWHEVETVSVPKMLQECHKNPAAKLGDLSAVIKK

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu