LOADING...
   YP_001305260.1;PX14343H
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001305260.1 Chemical properties of protein sequence with tag

Accession: YP_001305260.1
Description: gi|150010517|ref|YP_001305260.1| putative outer membrane protein, probably involved in nutrient binding [Parabacteroides distasonis ATCC 8503]
Organism: Parabacteroides distasonis ATCC 8503
  No Tag Tag
Residues(aa) 506 518
Molecular Weight (Dalton) 58019.38 59473.93
Isoelectric Point 4.97 5.26
Extinction Coefficient 90650 90650
Gravy -.39 -0.42
Number of Met 11 12
%Met 2.17 2.32
Number of Cys 6 6
%Cys 1.19 1.16
SEQUENCE  amino acids 518 aa; containing Tag mgsdkihhhhhh
>YP_001305260.1 gi|150010517|ref|YP_001305260.1| putative outer membrane protein, probably involved in nutrient binding [Parabacteroides distasonis ATCC 8503]
mgsdkihhhhhhMKINKIYIVSLCALFLSSCNNFLDEQPTGTMTTDSKLTSKESALALTN
SAYLKNTVFNKMTPGWGCNTILLLEYMTGKATSENSQSNYKDFQDLLVSDRSLYIEDWWQ
DCYAGIANCNLALQKLGEFENLDASLVNGYMAEVKFMRALYYFYLVRIFGDVPKITTVQS
ELGELQVSRAPVKEIYDEIIIPDLLEAEQSDLAFSDHTGRVSMGAVKALLADVYLTYAGY
PLQGGKSYYAESAKRSLEVIKSNEYTLFTDYESLRLPSQNNKGEFIYQVQFSLNKRHNES
VRIFLPSRSGISAYDLEYGSLIPTKEFVESFEKGDKRTEEKQYFFTNYKGHPSKFSPGAA
ELEFMDLNGYYIYKFFDQVAVDNTAKSDLNWSVYRYTDVLLMYAEAQVNADGTPNQQSID
IVNQIRGRAGLAPFKQTNASAFLEEVWDQRYFDLCYENKMWFDMLRTRKIRDDKSGEYVD
FIGYKTNWGKVYTETQLLFPIPLSERQANPNLTQNQGY

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu