LOADING...
   YP_001304549.1;SP13991A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001304549.1 Chemical properties of protein sequence with tag

Accession: YP_001304549.1
Description: gi|150009806|ref|YP_001304549.1| hypothetical protein BDI_3222 [Parabacteroides distasonis ATCC 8503]
Organism: Parabacteroides distasonis ATCC 8503
  No Tag Tag
Residues(aa) 136 148
Molecular Weight (Dalton) 16047.44 17501.99
Isoelectric Point 7.71 7.82
Extinction Coefficient 35410 35410
Gravy -.62 -0.72
Number of Met 4 5
%Met 2.94 3.38
Number of Cys 1 1
%Cys 0.74 0.68
SEQUENCE  amino acids 148 aa; containing Tag mgsdkihhhhhh
>YP_001304549.1 gi|150009806|ref|YP_001304549.1| hypothetical protein BDI_3222 [Parabacteroides distasonis ATCC 8503]
mgsdkihhhhhhMKTSVWGKSILALVFTFMCSLAISAASPKDYLYDTKEENGKIISKVVF
LQENGLLNKQVRYEFQYNENGKVSEKKAFRWDRTNDEWVPFYQITYQYDDQSGEIKTNYG
MWDKKKKNFSLNVQNMIIPSTNYEEIFS

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu