LOADING...
   YP_001304276.1;SP16569N
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001304276.1 Chemical properties of protein sequence with tag

Accession: YP_001304276.1
Description: gi|150009533|ref|YP_001304276.1| glycoside hydrolase family 33, candidate sialidase [Parabacteroides distasonis ATCC 8503]
Organism: Parabacteroides distasonis ATCC 8503
  No Tag Tag
Residues(aa) 541 553
Molecular Weight (Dalton) 60187.46 61642.01
Isoelectric Point 6.33 6.53
Extinction Coefficient 90870 90870
Gravy -.31 -0.34
Number of Met 18 19
%Met 3.33 3.44
Number of Cys 3 3
%Cys 0.55 0.54
SEQUENCE  amino acids 553 aa; containing Tag mgsdkihhhhhh
>YP_001304276.1 gi|150009533|ref|YP_001304276.1| glycoside hydrolase family 33, candidate sialidase [Parabacteroides distasonis ATCC 8503]
mgsdkihhhhhhMKKTFLYFCLLFIVQTAFAADSIYVREQQIPILIDRIDNVLYEMRIPA
QKGDVLNEITIQIGDNVDLSDIQAIRLFYSGVEAPSRKGEHFSPVTYISSHIPGNTRKAL
ESYSVRQDEVTAPLSRTVKLTSKQPMLKGINYFWVSIQMKPETSLLAKVATTMPNAQINN
KPINITWKGKVDERHVGIGVRQAGDDGSAAFRIPGLVTTNNGTLLGVYDIRYNSSVDLQE
KIDIGVSRSTDKGQTWEPMRVAMTFKQTDGLPHGQNGVGDPSILVDEKTNTIWVVAAWTH
GMGNERAWWNSMPGMTPDETAQLMLVKSEDDGKTWSEPINITSQVKDPSWYFLLQGPGRG
ITMQDGTLVFPIQFIDATRVPNAGIMYSKDRGKTWHLHNLARTNTTEAQVAEVEPGVLML
NMRDNRGGSRAVATTKDLGKTWTEHPSSRSALQESVCMASLIKVNAKDNITGKDLLLFSN
PNTTKGRNHITIKASLDGGLTWPTEHQVLLDEAEGWGYSCLSMIDKETVGIFYESSVAHM
TFQAVKLQDLIHQ

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu