LOADING...
   YP_001299918.1;GS13848A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001299918.1 Chemical properties of protein sequence with tag

Accession: YP_001299918.1
Description: gi|150005174|ref|YP_001299918.1| hypothetical protein BVU_2644 [Bacteroides vulgatus ATCC 8482]
Organism: Bacteroides vulgatus ATCC 8482
  No Tag Tag
Residues(aa) 489 501
Molecular Weight (Dalton) 56333.64 57788.19
Isoelectric Point 6.29 6.50
Extinction Coefficient 142210 142210
Gravy -.6 -0.63
Number of Met 15 16
%Met 3.07 3.19
Number of Cys 4 4
%Cys 0.82 0.80
SEQUENCE  amino acids 501 aa; containing Tag mgsdkihhhhhh
>YP_001299918.1 gi|150005174|ref|YP_001299918.1| hypothetical protein BVU_2644 [Bacteroides vulgatus ATCC 8482]
mgsdkihhhhhhMNRHALLSLLALLLCCSTSLPAQKAKTYIPWKNGKLVVSEEGRYLKHE
NGVPFFWLGETGWLMPQRLNRDEVSYYLNKCKDAGYNMVQVQVLNGVPSMNIYGQYSMTD
GFNFKDINRKGIYGYWDHMDYIIKSAASRGIYIGMVCIWGTPVEQGLMNEKEAVAYGKFL
AERYKDEPNIIWMIGGDIRGDNKTEVWDALANSIRSIDKGHLMTFHPRGRTTSATWFNDR
EWLDFNMFQSGHRRYGQRNGDGDYPIEENTEEDNWRFVEASQAKTPLKPVIDDEPIYEDI
PQGLHDPNETRWNQHDVRRYAYWSVFAGSFGHSYGHNDIMQFIRPGYGASFGADGRKKAW
WDALEDPGFNQMKYLKNLMLTFPFFERVPDQSVIAGTNGERYDRAIATRGNDYLLVYNYS
GRPMQIDLSKISGAKKNAWWYSAKDGKLEYIGEFDSKVTSFQHDSGYLSGNDQVLIVVDS
AKDYVQKAWTALPDAIQKWNK

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu