LOADING...
   YP_001297591.1;GS13522A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001297591.1 Chemical properties of protein sequence with tag

Accession: YP_001297591.1
Description: gi|150002847|ref|YP_001297591.1| hypothetical protein BVU_0247 [Bacteroides vulgatus ATCC 8482]
Organism: Bacteroides vulgatus ATCC 8482
  No Tag Tag
Residues(aa) 382 394
Molecular Weight (Dalton) 42377.17 43831.72
Isoelectric Point 4.92 5.30
Extinction Coefficient 53750 53750
Gravy -.34 -0.39
Number of Met 6 7
%Met 1.57 1.78
Number of Cys 6 6
%Cys 1.57 1.52
SEQUENCE  amino acids 394 aa; containing Tag mgsdkihhhhhh
>YP_001297591.1 gi|150002847|ref|YP_001297591.1| hypothetical protein BVU_0247 [Bacteroides vulgatus ATCC 8482]
mgsdkihhhhhhMKLKNLFTCTVTGLLLCTSCIKDEAPNAEADILNCILPAEMLTGTDID
YNRPYDKSLNAYPIYIEVNNGTDLTRLAPTFELTEGASIEPANGSTQNFTNPVRYTVTSE
DKNWHRTYAINIHYPETKSIPTVFNFENVKTVPYNKNEYYVLYEAASGYSTLTWSSGNQG
FALTGSGYTPNDFPTSISPNGRTGNCLQLITRKTGSLGTLVGMPIAAGNLFIGSFDIGSA
MSDALSATKFGTTFYYEPIKLVGYYKYKAGPEFYENGESTNRKDVFNIYALFYEKTKDVQ
MLDGHIAKNNYEHENMVAAAVITDTHETSEWTRFELDFNYEHYGKTIDPQKLANGGYNVS
IVLSASKDGDVFQGAPGSTLLIDDLELVCKQPLR

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu