LOADING...
   YP_001087438.1;SP19352A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001087438.1 Chemical properties of protein sequence with tag

Accession: YP_001087438.1
Description: gi|126698541|ref|YP_001087438.1| putative phage lipoprotein [Clostridium difficile 630]
Organism: CLOSTRIDIUM DIFFICILE 630
  No Tag Tag
Residues(aa) 186 198
Molecular Weight (Dalton) 21114.9 22569.45
Isoelectric Point 4.85 5.40
Extinction Coefficient 14900 14900
Gravy -.42 -0.50
Number of Met 3 4
%Met 1.61 2.02
Number of Cys 5 5
%Cys 2.69 2.53
SEQUENCE  amino acids 198 aa; containing Tag mgsdkihhhhhh
>YP_001087438.1 gi|126698541|ref|YP_001087438.1| putative phage lipoprotein [Clostridium difficile 630]
mgsdkihhhhhhMKKKVCFLFSILIVICLAIVGCSNSESPEESSKNNEPKKEEKKDKEVV
IGEKIISDKMEITINNIEFSYDVLPKVKESLYTHYPAESGKVYIDIAADIKNTQKQELNC
SDLLTIEANYNDGYKYSSQTIVEDETTGFTYDNISSIDPLETKGVRFIIDCPDEVKTSDK
PVILSFTFDGNKYVYKMK

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu