LOADING...
   TM1612;TM1612
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1612 Chemical properties of protein sequence with tag

Accession: TM1612
Description: TM1612 ATP synthase F1, subunit alpha (atpA)
Organism: THERMOTOGA MARITIMA
  No Tag Tag
Residues(aa) 503 515
Molecular Weight (Dalton) 56058.8 57513.35
Isoelectric Point 6.34 6.64
Extinction Coefficient 31290 31290
Gravy -.18 -0.21
Number of Met 11 12
%Met 2.19 2.33
Number of Cys 2 2
%Cys 0.40 0.39
SEQUENCE  amino acids 515 aa; containing Tag mgsdkihhhhhh
>TM1612 TM1612 ATP synthase F1, subunit alpha (atpA)
mgsdkihhhhhhMRINPGEITKVLEEKIKSFEEKIDLEDTGKVIQVGDGIARAYGLNKVM
VSELVEFVETGVKGVAFNLEEDNVGIIILGEYKDIKEGHTVRRLKRIIEVPVGEELLGRV
VNPLGEPLDGKGPINAKNFRPIEIKAPGVIYRKPVDTPLQTGIKAIDSMIPIGRGQRELI
IGDRQTGKTAIAIDTIINQKGQGVYCIYVAIGQKKSAIARIIDKLRQYGAMEYTTVVVAS
ASDPASLQYIAPYAGCAMGEYFAYSGRDALVVYDDLSKHAVAYRQLSLLMRRPPGREAYP
GDIFYLHSRLLERAVRLNDKLGGGSLTALPIVETQANDISAYIPTNVISITDGQIYLEPG
LFYAGQRPAINVGLSVSRVGGSAQIKAMKQVAGMLRIDLAQYRELETFAQFATELDPATR
AQIIRGQRLMELLKQEQYSPMPVEEQVVVLFAGVRGYLDDLPVEEVRRFEKEFLRFMHEK
HQDILDDIKTKKELTSETEEKLKKAIEEFKTTFRV

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu