LOADING...
   TM1526;TM1526
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1526 Chemical properties of protein sequence with tag

Accession: TM1526
Description: TM1526 hypothetical protein
Organism: THERMOTOGA MARITIMA
  No Tag Tag
Residues(aa) 145 157
Molecular Weight (Dalton) 17192.62 18647.17
Isoelectric Point 4.88 5.38
Extinction Coefficient 14440 14440
Gravy -.6 -0.67
Number of Met 3 4
%Met 2.07 2.55
Number of Cys 0 0
%Cys 0.00 0.00
SEQUENCE  amino acids 157 aa; containing Tag mgsdkihhhhhh
>TM1526 TM1526 hypothetical protein
mgsdkihhhhhhMKVSDILTVAIRLEEEGERFYRELSEHFNGEIKKTFLELADQERIHAE
IFRKMSDQENWDEVDSYLAGYAFYEVFPDTSEILRRKDLTLKEVLDIAISVEKDSIILYY
ELKDGLVNSDAQKTVKKIIDQEKEHLRKLLEMKREST

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu