LOADING...
   TM1394;TM1394
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1394 Chemical properties of protein sequence with tag

Accession: TM1394
Description: TM1394 conserved hypothetical protein
Organism: THERMOTOGA MARITIMA
  No Tag Tag
Residues(aa) 290 302
Molecular Weight (Dalton) 32538.84 33993.39
Isoelectric Point 5.33 5.85
Extinction Coefficient 28420 28420
Gravy -.12 -0.18
Number of Met 5 6
%Met 1.72 1.99
Number of Cys 4 4
%Cys 1.38 1.32
SEQUENCE  amino acids 302 aa; containing Tag mgsdkihhhhhh
>TM1394 TM1394 conserved hypothetical protein
mgsdkihhhhhhMIYYGTMFDHKVRFSIVRMREVVEEARNRHALSYLATVVLGRALIGAA
LVTPWLAEKERWTLDIEGNGPIRRVVAQSTSEFTVRGYVANPKVELPLNEKGKFDVAGAI
GQGVLRVVRDLGLKTPFVSQVPLVSGEIAEDLAYYFAVSEQIPSAFSIGVLVDSDGVKIA
GGFAVQIIDRTLEQEKVEMIEKNIKNLPSISKLFQEAEPLDVLERIFGEKVGFVETAEIK
YKCDCNREKAKNALLVLDKKELEDMRKEGKGEVVCKWCNTRYVFSEEELEELLKFKVDDS
GS

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu