LOADING...
   TM1158;TM1158
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1158 Chemical properties of protein sequence with tag

Accession: TM1158
Description: TM1158 conserved hypothetical protein
Organism: THERMOTOGA MARITIMA
  No Tag Tag
Residues(aa) 227 239
Molecular Weight (Dalton) 26898.77 28353.32
Isoelectric Point 5.66 6.18
Extinction Coefficient 38390 38390
Gravy -.45 -0.51
Number of Met 7 8
%Met 3.08 3.35
Number of Cys 1 1
%Cys 0.44 0.42
SEQUENCE  amino acids 239 aa; containing Tag mgsdkihhhhhh
>TM1158 TM1158 conserved hypothetical protein
mgsdkihhhhhhMRVLAIRHVEIEDLGMMEDIFREKNWSFDYLDTPKGEKLERPLEEYSL
VVLLGGYMGAYEEEKYPFLKYEFQLIEEILKKEIPFLGICLGSQMLAKVLGASVYRGKNG
EEIGWYFVEKVSDNKFFREFPDRLRVFQWHGDTFDLPRRATRVFTSEKYENQGFVYGKAV
GLQFHIEVGARTMKRWIEAYKDELEKKKIDPRLLLETAEREEKVLKGLLRSLLERMVES

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu