LOADING...
   TM1040;TM1040
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1040 Chemical properties of protein sequence with tag

Accession: TM1040
Description: TM1040 histidinol-phosphate aminotransferase (hisC)
Organism: THERMOTOGA MARITIMA
  No Tag Tag
Residues(aa) 335 347
Molecular Weight (Dalton) 39295.93 40750.48
Isoelectric Point 5.38 5.79
Extinction Coefficient 25330 25330
Gravy -.33 -0.38
Number of Met 9 10
%Met 2.69 2.88
Number of Cys 1 1
%Cys 0.30 0.29
SEQUENCE  amino acids 347 aa; containing Tag mgsdkihhhhhh
>TM1040 TM1040 histidinol-phosphate aminotransferase (hisC)
mgsdkihhhhhhMNPLDLIAKRAYPYETEKRDKTYLALNENPFPFPEDLVDEVFRRLNSD
ALRIYYDSPDEELIEKILSYLDTDFLSKNNVSVGNGADEIIYVMMLMFDRSVFFPPTYSC
YRIFAKAVGAKFLEVPLTKDLRIPEVNVGEGDVVFIPNPNNPTGHVFEREEIERILKTGA
FVALDEAYYEFHGESYVDFLKKYENLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNRVR
LPFNVSYVSQMFAKVALDHREIFEERTKFIVEERERMKSALREMGYRITDSRGNFVFVFM
EKEEKERLLEHLRTKNVAVRSFREGVRITIGKREENDMILRELEVFK

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu