LOADING...
   TM1009;TM1009
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1009 Chemical properties of protein sequence with tag

Accession: TM1009
Description: TM1009 oxidoreductase, aldo/keto reductase family
Organism: THERMOTOGA MARITIMA
  No Tag Tag
Residues(aa) 286 298
Molecular Weight (Dalton) 33242.76 34697.31
Isoelectric Point 5.97 6.33
Extinction Coefficient 45380 45380
Gravy -.33 -0.38
Number of Met 10 11
%Met 3.50 3.69
Number of Cys 3 3
%Cys 1.05 1.01
SEQUENCE  amino acids 298 aa; containing Tag mgsdkihhhhhh
>TM1009 TM1009 oxidoreductase, aldo/keto reductase family
mgsdkihhhhhhMQVPKVTLNNGVEMPILGYGVFQIPPEKTEECVYEAIKVGYRLIDTAA
SYMNEEGVGRAIKRAIDEGIVRREELFVTTKLWVSDVGYESTKKAFEKSLKKLQLEYIDL
YLIHQPFGDVHCAWKAMEEMYKDGLVRAIGVSNFYPDRLMDLMVHHEIVPAVNQIEIHPF
YQRQEEIEFMRNYNIQPEAWGPFAEGRKNIFQNGVLRSIAEKYGKTVAQVILRWLTQKGI
VAIPKTVRRERMKENISIFDFELTQEDMEKIATLDEGQSAFFSHRDPEVVKWICSLKR

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu