LOADING...
   TM0312;TM0312
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0312 Chemical properties of protein sequence with tag

Accession: TM0312
Description: TM0312 conserved hypothetical protein
Organism: THERMOTOGA MARITIMA
  No Tag Tag
Residues(aa) 328 340
Molecular Weight (Dalton) 36537.08 37991.63
Isoelectric Point 5.69 6.03
Extinction Coefficient 43430 43430
Gravy -.14 -0.19
Number of Met 7 8
%Met 2.13 2.35
Number of Cys 3 3
%Cys 0.91 0.88
SEQUENCE  amino acids 340 aa; containing Tag mgsdkihhhhhh
>TM0312 TM0312 conserved hypothetical protein
mgsdkihhhhhhMKPLRKIRLGIVGCGIAARELHLPALKNLSHLFEITAVTSRTRSHAEE
FAKMVGNPAVFDSYEELLESGLVDAVDLTLPVELNLPFIEKALRKGVHVICEKPISTDVE
TGKKVVELSEKSEKTVYIAENFRHVPAFWKAKELVESGAIGDPVFMNWQIWVGMDENNKY
VHTDWRKKPKHVGGFLSDGGVHHAAAMRLILGEIEWISAVAKDLSPLLGGMDFLSSIFEF
ENGTVGNYTISYSLKGNERFEITGTKGKISISWDKIVLNEEEMKVPQENSYQKEFEDFYQ
VVAEGKPNDLGSPVQALKDLAFIEACVRSAGNKVFVSSLL

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu