LOADING...
   TM0231;TM0231
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0231 Chemical properties of protein sequence with tag

Accession: TM0231
Description: TM0231 UDP-N-acetylmuramate--alanine ligase (murC)
Organism: THERMOTOGA MARITIMA
  No Tag Tag
Residues(aa) 457 469
Molecular Weight (Dalton) 51868.97 53323.52
Isoelectric Point 5.71 5.95
Extinction Coefficient 39310 39310
Gravy -.39 -0.42
Number of Met 8 9
%Met 1.75 1.92
Number of Cys 0 0
%Cys 0.00 0.00
SEQUENCE  amino acids 469 aa; containing Tag mgsdkihhhhhh
>TM0231 TM0231 UDP-N-acetylmuramate--alanine ligase (murC)
mgsdkihhhhhhMKIHFVGIGGIGMSAVALHEFSNGNDVYGSNIEETERTAYLRKLGIPI
FVPHSADNWYDPDLVIKTPAVRDDNPEIVRARMERVPIENRLHYFRDTLKREKKEEFAVT
GTDGKTTTTAMVAHVLKHLRKSPTVFLGGIMDSLEHGNYEKGNGPVVYELDESEEFFSEF
SPNYLIITNARGDHLENYGNSLTRYRSAFEKISRNTDLVVTFAEDELTSHLGDVTFGVKK
GTYTLEMRSASRAEQKAMVEKNGKRYLELKLKVPGFHNVLNALAVIALFDSLGYDLAPVL
EALEEFRGVHRRFSIAFHDPETNIYVIDDYAHTPDEIRNLLQTAKEVFENEKIVVIFQPH
RYSRLEREDGNFAKALQLADEVVVTEVYDAFEEKKNGISGKMIWDSLKSLGKEAYFVEKL
PELEKVISVSENTVFLFVGAGDIIYSSRRFVERYQSSKSSPSRVLGSNK

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu