LOADING...
   TM0018;TM0018
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0018 Chemical properties of protein sequence with tag

Accession: TM0018
Description: TM0018 pyruvate ferredoxin oxidoreductase, beta subunit (porB)
Organism: THERMOTOGA MARITIMA
  No Tag Tag
Residues(aa) 324 336
Molecular Weight (Dalton) 36383.04 37837.59
Isoelectric Point 8.91 8.90
Extinction Coefficient 44350 44350
Gravy -.34 -0.38
Number of Met 7 8
%Met 2.16 2.38
Number of Cys 4 4
%Cys 1.23 1.19
SEQUENCE  amino acids 336 aa; containing Tag mgsdkihhhhhh
>TM0018 TM0018 pyruvate ferredoxin oxidoreductase, beta subunit (porB)
mgsdkihhhhhhMPVNIKQLAQEFDKKEIGITQGHRLCPGCGAPITVKFVMMIARHLGYE
PVVGLATGCLEVSTSIYPYTAWSVPYIHNAFENVAATMSGVETAYKALKNKGKIPEDKKY
AFIAFGGDGGTYDIGLQSLSGMLERGHKVLYVLYDNEGYMNTGNQRSGSTPPGSDTTTAP
VGKKLPGKVQLKKNIVEIVAAHENVYAATASLSEPMDFFAKVEKALNFDGPSFLAVFSPC
VRFWRVNDDKTVEISKLAVETKYWPLYEVERGVYRVTRKPRQFKPVEEFLKAQGRFRKLL
SRPDAKEIVDELQEYVDRRWERLLTLEEVTKDKPIR

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu