LOADING...
   NP_904517.1;C.KN20883A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_904517.1 Chemical properties of protein sequence with tag

Accession: NP_904517.1
Description: gi|34540038|ref|NP_904517.1| immunoreactive 32 kDa antigen PG49 [Porphyromonas gingivalis W83]
Organism: PORPHYROMONAS GINGIVALIS W83
  No Tag Tag
Residues(aa) 333 345
Molecular Weight (Dalton) 37137.17 38591.72
Isoelectric Point 5.32 5.94
Extinction Coefficient 53860 53860
Gravy -.27 -0.32
Number of Met 5 6
%Met 1.50 1.74
Number of Cys 1 1
%Cys 0.30 0.29
SEQUENCE  amino acids 345 aa; containing Tag mgsdkihhhhhh
>NP_904517.1 gi|34540038|ref|NP_904517.1| immunoreactive 32 kDa antigen PG49 [Porphyromonas gingivalis W83]
mgsdkihhhhhhMKKYLLYASLLTSVLLFSCSKNNPNEPVEDRSIEISIRVDDFTKTGEA
VRYERNQGSAAERLITNLYLLLFDQSGANPAKYYITGNTFTGGTWLPDDMKVKLDMTQSE
AGERKVYVVANVDNAVKTALDAVANESDLQTVKRTTAMPWSTDIASPFLMSGNKTHDFLA
NRLLDNVPLVRAIAKVELNISLSEKFQIVPIIVNGSLSEFKFRYVNFDKETYVVKPTTKP
DNLISSANGVWPQITDWTVWGASLNTSPAPDAGTGYTLDANGKVTALRIVTYLNERDSKG
ATVEVALPRVDDGTLPPPEFGPELYRLPLPDKILRNHWYKYEVEI

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu