LOADING...
   NP_812419.1;SP15308D
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_812419.1 Chemical properties of protein sequence with tag

Accession: NP_812419.1
Description: gi|29348916|ref|NP_812419.1| hypothetical protein BT3507 [Bacteroides thetaiotaomicron VPI-5482]
Organism: BACTEROIDES THETAIOTAOMICRON VPI-5482
  No Tag Tag
Residues(aa) 353 365
Molecular Weight (Dalton) 39919.08 41373.63
Isoelectric Point 4.66 4.91
Extinction Coefficient 59710 59710
Gravy -.49 -0.53
Number of Met 6 7
%Met 1.70 1.92
Number of Cys 2 2
%Cys 0.57 0.55
SEQUENCE  amino acids 365 aa; containing Tag mgsdkihhhhhh
>NP_812419.1 gi|29348916|ref|NP_812419.1| hypothetical protein BT3507 [Bacteroides thetaiotaomicron VPI-5482]
mgsdkihhhhhhMKKIYTLAALAAMTMLGTSCNSEWEDEQYEHYISFSSQLDSKGVTNIY
VPYSRHDAEGNYAEGGEGRSNYQLPILVSGSTDNPSNVTVHVAHDADTLNILNYARYATR
TELYYEDMGAEGLAYASYPESLQIKAGENKGLLDLKFDFRNIDMSEKWVLPLQIVDDASY
NYVAHPRKDYAKAILRIFPFNDYSGDYSGTGITNKVVTGYDGDGKPIETAESITKSSIRG
YVIDEQTIFTYAGIVDEDYTDRRKYKIKFAFNGETNGSVTISCDNAEEIGFELNKDVTPS
FRISSSMDDAKPYLEHRYVIINNVDYYFNYIPVEGTIIRYHVKGTLTLSRDINTQIPDED
QAIEW

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu