LOADING...
   NP_811570.1;C.KN13462A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_811570.1 Chemical properties of protein sequence with tag

Accession: NP_811570.1
Description: gi|29348067|ref|NP_811570.1| hypothetical protein BT2657 [Bacteroides thetaiotaomicron VPI-5482]
Organism: BACTEROIDES THETAIOTAOMICRON VPI-5482
  No Tag Tag
Residues(aa) 338 350
Molecular Weight (Dalton) 38961.21 40415.76
Isoelectric Point 4.84 5.18
Extinction Coefficient 62800 62800
Gravy -.3 -0.35
Number of Met 12 13
%Met 3.55 3.71
Number of Cys 5 5
%Cys 1.48 1.43
SEQUENCE  amino acids 350 aa; containing Tag mgsdkihhhhhh
>NP_811570.1 gi|29348067|ref|NP_811570.1| hypothetical protein BT2657 [Bacteroides thetaiotaomicron VPI-5482]
mgsdkihhhhhhMHNKKRNIISGFISTVLGIVLINFAFSSCERIYEDLAPCPHGVSLRFI
YDYNMEYANAFAKKVDCLTLLVYDENGNYVDTRIVTGTELQDENYRMKLDLKQGNYHFVA
YGGLACNKSSFLMKYTPGEGTGYTDLQVELDSECLTNPRRKNLHGLYWGELTLATADLYS
EGTVEMMKNTNNIRVVLQQMNGEPVDDKKFEFEITDDNILFSYDNNLLENGMVTYTPWAQ
GQASAGFTDEGREVVVAYAELSTSRLMVRDWYSPKLTVRRKADGVEIINIPLINYLLMLK
SDLYASMDSQEFLDRESEWSMIFFLSPNLEWIKTYIKINDWTVRINDIRQ

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu