LOADING...
   NP_811172.1;GS13194A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_811172.1 Chemical properties of protein sequence with tag

Accession: NP_811172.1
Description: gi|29347669|ref|NP_811172.1| hypothetical protein BT2259 [Bacteroides thetaiotaomicron VPI-5482]
Organism: BACTEROIDES THETAIOTAOMICRON VPI-5482
  No Tag Tag
Residues(aa) 488 500
Molecular Weight (Dalton) 54864.15 56318.70
Isoelectric Point 4.59 4.78
Extinction Coefficient 106230 106230
Gravy -.31 -0.35
Number of Met 18 19
%Met 3.69 3.80
Number of Cys 7 7
%Cys 1.43 1.40
SEQUENCE  amino acids 500 aa; containing Tag mgsdkihhhhhh
>NP_811172.1 gi|29347669|ref|NP_811172.1| hypothetical protein BT2259 [Bacteroides thetaiotaomicron VPI-5482]
mgsdkihhhhhhMIMKKKILAYALSALTCGLFTSCSDWLDINHDPNTAEKVDPGYLFNYV
AVNWAGTRTGGDFYIPLSMSSQCQVDGGLDYGGWDESVYTISPYSTGNTWKHYYSVGGNN
LMLAIKNAEEADPVNHNAIAQCKILLAEHMYEATMLWGDIPFTESWNGTIKYPKFDSQES
VLNGVLSLLDEALQIMDLNDANAIDEYDIYYKGDMNKWMTLAKSLKFRTLMVMVDKDPSK
ATAIGTLLQAGGMVSSASDNLVFPYSAEPGNQNPKYELIELVGGTQILFFASNYMLKPMQ
ERNDPRIPCYFEPGADGVYRGLGNREPAVTDDKDNMLSSVVSSYLFRKDAPELIYSCQEQ
LLLEAEAYARGLGVAQNLSKANELYKKGIREACAFYGVAEADIDTYVTGLPELTALTQEK
ALYEIHMQQWIDLMDRPFEEFVQWRRSGTAGNEVPTLQVPEDATSKELIRRWEYSPEEMT
ANINAPKESPKIWEKLWFDL

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu