LOADING...
   NP_810851.1;FR15002A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_810851.1 Chemical properties of protein sequence with tag

Accession: NP_810851.1
Description: gi|29347348|ref|NP_810851.1| hypothetical protein BT1938 [Bacteroides thetaiotaomicron VPI-5482]
Organism: BACTEROIDES THETAIOTAOMICRON VPI-5482
  No Tag Tag
Residues(aa) 399 411
Molecular Weight (Dalton) 44384.11 45838.66
Isoelectric Point 4.52 4.75
Extinction Coefficient 67730 67730
Gravy -.38 -0.42
Number of Met 8 9
%Met 2.01 2.19
Number of Cys 3 3
%Cys 0.75 0.73
SEQUENCE  amino acids 411 aa; containing Tag mgsdkihhhhhh
>NP_810851.1 gi|29347348|ref|NP_810851.1| hypothetical protein BT1938 [Bacteroides thetaiotaomicron VPI-5482]
mgsdkihhhhhhMSGTAEVNPITVDVYLDITVENISTLKDLTVKFDNYDEDLHYVKEVTD
NSVKVDGIIPGIYSVTVSGTAIDTENNEYYINGNSVNAALFKHGSALNIEVQGLKVSPLI
FKEIYYCGSRPEKGGVYFRDQFYEIYNNSADILYLDGIYFANLTPGTATTKLPIWPEADG
NNYAYGERVWKFPGNGTEYPLAPGESCIISQFAANHQLDIYNPQSPIDGSSSEFEFNMNN
PNFPDQAAYDMQHVFYQGKAEMGSIPQYLTSVFGGAYVIFRVPEGEAWDPVNDENMKTTD
LSKPNSNVYYAKIPIKYVLDAVEAVNNESKMNAKRVPGVLDAGITWVGATYCGLGIARKL
STDEEGNPIIREETGTYIYQDTNNSTDDFERGVVPVMRRNGAKMPSWNHTL

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu