LOADING...
   NP_809759.1;SP16701A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_809759.1 Chemical properties of protein sequence with tag

Accession: NP_809759.1
Description: gi|29346256|ref|NP_809759.1| hypothetical protein BT0846 [Bacteroides thetaiotaomicron VPI-5482]
Organism: BACTEROIDES THETAIOTAOMICRON VPI-5482
  No Tag Tag
Residues(aa) 119 131
Molecular Weight (Dalton) 13557.5 15012.05
Isoelectric Point 4.59 5.39
Extinction Coefficient 24410 24410
Gravy -.38 -0.51
Number of Met 2 3
%Met 1.68 2.29
Number of Cys 2 2
%Cys 1.68 1.53
SEQUENCE  amino acids 131 aa; containing Tag mgsdkihhhhhh
>NP_809759.1 gi|29346256|ref|NP_809759.1| hypothetical protein BT0846 [Bacteroides thetaiotaomicron VPI-5482]
mgsdkihhhhhhMKNILFTLFAILILTSCSKDEEDWTELNSNNIIGYWSTGIEGTHKLLS
FDEDGTGSFGIYSNATPISFQMFDYKIEEGRIYIYDVYPDEKTPYYLDCKISGTTLKVET
GSEAGTYKKQK

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu