LOADING...
   NP_809341.1;GE2184A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_809341.1 Chemical properties of protein sequence with tag

Accession: NP_809341.1
Description: gi|29345838|ref|NP_809341.1| phenylacetate-coenzyme A ligase [Bacteroides thetaiotaomicron VPI-5482]
Organism: BACTEROIDES THETAIOTAOMICRON VPI-5482
  No Tag Tag
Residues(aa) 435 447
Molecular Weight (Dalton) 49377.07 50831.62
Isoelectric Point 5.94 6.26
Extinction Coefficient 35870 35870
Gravy -.4 -0.43
Number of Met 15 16
%Met 3.45 3.58
Number of Cys 6 6
%Cys 1.38 1.34
SEQUENCE  amino acids 447 aa; containing Tag mgsdkihhhhhh
>NP_809341.1 gi|29345838|ref|NP_809341.1| phenylacetate-coenzyme A ligase [Bacteroides thetaiotaomicron VPI-5482]
mgsdkihhhhhhMSTQYWEEEIEIMSREKLQELQLQRLKKTINIAANSPYYKEVFSKNGI
TGDSIQSLDDIRKIPFTTKSDMRANYPFGLVAGDMKRDGVRIHSSSGTTGNPTVIVHSQH
DLDSWANLVARCLYMVGIRKTDVFQNSSGYGMFTGGLGFQYGAERLGCLTVPAAAGNSKR
QIKFISDFKTTALHAIPSYAIRLAEVFQEEGIDPRETTLKTLVIGAEPHTDEQRRKIERM
LNVKAYNSFGMTEMNGPGVAFECQEQNGMHFWEDCYLVEIIDPETGEPVPEGEIGELVLT
TLDREMMPLIRYRTRDLTRILPGKCPCGRTHLRIDRIKGRSDDMFIIKGVNIFPMQVEKI
LVQFPELGSNYLITLETVNNQDEMIVEVELSDLSTDNYIELEKIRRDIIRQLKDEILVTP
KVKLVKKGSLPQSEGKAVRVKDLRDNK

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu