LOADING...
   NP_463836.1;MJ14477B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_463836.1 Chemical properties of protein sequence with tag

Accession: NP_463836.1
Description: gi|16802351|ref|NP_463836.1| similar to low specificity L-allo-threonine aldolase [Listeria monocytogenes EGD-e]
Organism: LISTERIA MONOCYTOGENES EGD-E
  No Tag Tag
Residues(aa) 358 370
Molecular Weight (Dalton) 39896.18 41350.73
Isoelectric Point 4.89 5.18
Extinction Coefficient 40340 40340
Gravy -.18 -0.23
Number of Met 4 5
%Met 1.12 1.35
Number of Cys 5 5
%Cys 1.40 1.35
SEQUENCE  amino acids 370 aa; containing Tag mgsdkihhhhhh
>NP_463836.1 gi|16802351|ref|NP_463836.1| similar to low specificity L-allo-threonine aldolase [Listeria monocytogenes EGD-e]
mgsdkihhhhhhMTNTLKTSYQKTPYKLGGNGPRNVGVLTEALQNIDDNLESDIYGNGAV
IEDFETKIAKILGKQSAVFFPSGTMAQQIALRIWADRKENRRVAYHPLSHLEIHEQDGLK
ELQQITPLLLGTANQLLTIDDIKSLREPVSSVLIELPQREIGGQLPAFEELEKISEYCHE
QGISLHLDGARLWEITPFYQKSAEEICALFDSVYVSFYKGIGGIAGAILAGNDDFVQEAK
IWKRRYGGDLISLYPYILSADYYFEKRIGKMAEYFEAAKGLAERFNSCSGVKTVPEVPVS
NMFHVYFENSADEIGAILTKIQDETGVGISGYLQEKSADVCAFEVSVGDAFAEIPAKNLE
LVFRCLEKEL

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu