LOADING...
   NP_370957.1;SP17980D
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_370957.1 Chemical properties of protein sequence with tag

Accession: NP_370957.1
Description: gi|15923423|ref|NP_370957.1| exotoxin 15 [Staphylococcus aureus subsp. aureus Mu50]
Organism: STAPHYLOCOCCUS AUREUS MU50
  No Tag Tag
Residues(aa) 227 239
Molecular Weight (Dalton) 25438.46 26893.01
Isoelectric Point 8.79 8.78
Extinction Coefficient 14900 14900
Gravy -.61 -0.67
Number of Met 4 5
%Met 1.76 2.09
Number of Cys 0 0
%Cys 0.00 0.00
SEQUENCE  amino acids 239 aa; containing Tag mgsdkihhhhhh
>NP_370957.1 gi|15923423|ref|NP_370957.1| exotoxin 15 [Staphylococcus aureus subsp. aureus Mu50]
mgsdkihhhhhhMKLKNIAKASLALGILTTGMITTTAQPVKASTLEVRSQATQDLSEYYK
GRGFELTNVTGYKYGNKVTFIDNSQQIDVTLTGNEKLTVKDDDEVSNVDVFVVREGSDKS
AITTSIGGITKTNGTQHKDTVQNVNLSVSKSTGQHTTSVTSEYYSIYKEEISLKELDFKL
RKHLIDKHDLYKTEPKDSKIRITMKNGGYYTFELNKKLQPHRMGDTIDSRNIEKIEVNL

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu