LOADING...
   NP_253659.1;SP19119A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_253659.1 Chemical properties of protein sequence with tag

Accession: NP_253659.1
Description: gi|15600165|ref|NP_253659.1| hypothetical protein [Pseudomonas aeruginosa PA01]
Organism: PSEUDOMONAS AERUGINOSA
  No Tag Tag
Residues(aa) 248 260
Molecular Weight (Dalton) 27852.42 29306.97
Isoelectric Point 5.98 6.34
Extinction Coefficient 35410 35410
Gravy -.3 -0.36
Number of Met 4 5
%Met 1.61 1.92
Number of Cys 3 3
%Cys 1.21 1.15
SEQUENCE  amino acids 260 aa; containing Tag mgsdkihhhhhh
>NP_253659.1 gi|15600165|ref|NP_253659.1| hypothetical protein [Pseudomonas aeruginosa PA01]
mgsdkihhhhhhMRLLKFAALGSLVVLLSACQSLFKPGLDDPLPTERLASEHLKPGCQGE
QCPLVNIDTLKFPDEPQLDPIVERALLEMTRENNETPLPASLAAYERQFLDSAEPGWSSY
LQAKVREQHDGLVIIELSSYLFTGGAHGMPGRGFINYDRRQHKVLSLQDMLVPGQEEAFW
KQAELAHKAWLLANKLDQDADFQKTWPFQRTPHVALTFGAVTLKYDAYSIAPYSYAHPEL
KIPYPRLNGIVKPNLFPGRG

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu