LOADING...
   NP_251743.1;SP16046A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_251743.1 Chemical properties of protein sequence with tag

Accession: NP_251743.1
Description: gi|15598249|ref|NP_251743.1| probable hydrolytic enzyme [Pseudomonas aeruginosa PA01]
Organism: PSEUDOMONAS AERUGINOSA
  No Tag Tag
Residues(aa) 335 347
Molecular Weight (Dalton) 37482.9 38937.45
Isoelectric Point 7.68 7.75
Extinction Coefficient 65320 65320
Gravy -.23 -0.29
Number of Met 9 10
%Met 2.69 2.88
Number of Cys 4 4
%Cys 1.19 1.15
SEQUENCE  amino acids 347 aa; containing Tag mgsdkihhhhhh
>NP_251743.1 gi|15598249|ref|NP_251743.1| probable hydrolytic enzyme [Pseudomonas aeruginosa PA01]
mgsdkihhhhhhMSLPRLSLSLCLALACGPALASQAPVYGERLEGFDYAYPVHYLDFTSQ
GQPLSMAYLDVAPKKANGRTILLMHGKNFCAGTWERTIDVLADAGYRVIAVDQVGFCKSS
KPAHYQYSFQQLAANTHALLERLGVARASVIGHSMGGMLATRYALLYPRQVERLVLVNPI
GLEDWKALGVPWRSVDDWYRRDLQTSAEGIRQYQQATYYAGEWRPEFDRWVQMQAGMYRG
KGRESVAWNSALTYDMIFTQPVVYELDRLQMPTLLLIGEKDNTAIGKDAAPAELKARLGN
YAQLGKDAARRIPQATLVEFPDLGHTPQIQAPERFHQALLEGLQTQP

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu