LOADING...
   NM_002092;NM_002092
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NM_002092 Chemical properties of protein sequence with tag

Accession: NM_002092
Description: NM_002092 Homo sapiens G-rich RNA sequence binding factor 1 (GRSF1), transcript variant 1, mRNA, coding region:84-1526
Organism: HOMO SAPIENS
  No Tag Tag
Residues(aa) 480 492
Molecular Weight (Dalton) 53133.45 54588.00
Isoelectric Point 5.83 6.08
Extinction Coefficient 34840 34840
Gravy -.33 -0.36
Number of Met 13 14
%Met 2.71 2.85
Number of Cys 9 9
%Cys 1.88 1.83
SEQUENCE  amino acids 492 aa; containing Tag mgsdkihhhhhh
>NM_002092 NM_002092 Homo sapiens G-rich RNA sequence binding factor 1 (GRSF1), transcript variant 1, mRNA, coding region:84-1526
mgsdkihhhhhhMAGTRWVLGALLRGCGCNCSSCRRTGAACLPFYSAAGSIPSGVSGRRR
LLLLLGAAAAAASQTRGLQTGPVPPGRLAGPPAVATSAAAAAAASYPALRASLLPQSLAA
AAAVPTRSYSQESKTTYLEDLPPPPEYELAPSKLEEEVDDVFLIRAQGLPWSCTMEDVLN
FFSDCRIRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEVYEIN
NEDVDALMKSLQVKSSPVVNDGVVRLRGLPYSCNEKDIVDFFAGLNIVDITFVMDYRGRR
KTGEAYVQFEEPEMANQALLKHREEIGNRYIEIFPSRRNEVRTHVGSYKGKKIASFPTAK
YITEPEMVFEEHEVNEDIQPMTAFESEKEIELPKEVPEKLPEAADFGTTSSLHFVHMRGL
PFQANAQDIINFFAPLKPVRITMEYSSSGKATGEADVHFETHEDAVAAMLKDRSHVHHRY
IELFLNSCPKGK

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu