LOADING...
   BC043071;BC043071
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BC043071 Chemical properties of protein sequence with tag

Accession: BC043071
Description: BC043071 Mus musculus U2 small nuclear ribonucleoprotein auxiliary factor (U2AF) 2, mRNA (cDNA clone MGC:57976 IMAGE:6403830), complete cds, coding region:146-1561
Organism: MUS MUSCULUS
  No Tag Tag
Residues(aa) 471 483
Molecular Weight (Dalton) 53117.85 54572.40
Isoelectric Point 9.18 9.18
Extinction Coefficient 28880 28880
Gravy -.59 -0.62
Number of Met 16 17
%Met 3.40 3.52
Number of Cys 6 6
%Cys 1.27 1.24
SEQUENCE  amino acids 483 aa; containing Tag mgsdkihhhhhh
>BC043071 BC043071 Mus musculus U2 small nuclear ribonucleoprotein auxiliary factor (U2AF) 2, mRNA (cDNA clone MGC:57976 IMAGE:6403830), complete cds, coding region:146-1561
mgsdkihhhhhhMSDFDEFERQLNENKQERDKENRHRKRSHSRSRSRDRKRRSRSRDRRN
RDQRSASRDRRRRSKPLTRGAKEEHGGLIRSPRHEKKKKVRKYWDVPPPGFEHITPMQYK
AMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDF
FNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRR
PHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAF
NLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLSTIN
QTPVTLQVPGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLV
KSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRR
DFW

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu