LOADING...
   BC030493;WS20613E
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BC030493 Chemical properties of protein sequence with tag

Accession: BC030493
Description: BC030493 Mus musculus RNA binding motif protein 39, mRNA (cDNA clone MGC:40964 IMAGE:5400675), complete cds, coding region:452-1555
Organism: MUS MUSCULUS
  No Tag Tag
Residues(aa) 367 379
Molecular Weight (Dalton) 39816.16 41270.71
Isoelectric Point 6.12 6.46
Extinction Coefficient 21430 21430
Gravy -.13 -0.18
Number of Met 13 14
%Met 3.54 3.69
Number of Cys 4 4
%Cys 1.09 1.06
SEQUENCE  amino acids 379 aa; containing Tag mgsdkihhhhhh
>BC030493 BC030493 Mus musculus RNA binding motif protein 39, mRNA (cDNA clone MGC:40964 IMAGE:5400675), complete cds, coding region:452-1555
mgsdkihhhhhhMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVS
SVPLAIGLTGQRVLGVPIIVQASQAEKNRAAAMANNLQKGSAGPMRLYVGSLHFNITEDM
LRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLNGFELAGRPMKVGH
VTERTDASSASSFLDSDELERTGIDLGTTGRLQLMARLAEGTGLQIPPAAQQALQMSGSL
AFGAVADLQTRLSQQTEASALAAAASVQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVI
EECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTY
HNLFPDSMTATQLLVPSRR

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu