LOADING...
   BC013200;WT2001B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BC013200 Chemical properties of protein sequence with tag

Accession: BC013200
Description: BC013200 Homo sapiens lymphocyte-specific protein tyrosine kinase, mRNA (cDNA clone MGC:17196 IMAGE:4341278), complete cds, coding region:101-1720
Organism: HOMO SAPIENS
  No Tag Tag
Residues(aa) 539 551
Molecular Weight (Dalton) 61187.04 62641.59
Isoelectric Point 5.11 5.36
Extinction Coefficient 94310 94310
Gravy -.45 -0.48
Number of Met 11 12
%Met 2.04 2.18
Number of Cys 9 9
%Cys 1.67 1.63
SEQUENCE  amino acids 551 aa; containing Tag mgsdkihhhhhh
>BC013200 BC013200 Homo sapiens lymphocyte-specific protein tyrosine kinase, mRNA (cDNA clone MGC:17196 IMAGE:4341278), complete cds, coding region:101-1720
mgsdkihhhhhhMGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPL
VTYEGSNPPASPLQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQE
GFIPFNFVAKANSLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVR
DFDQNQGEVVKHYKIRNLDNGGFYISPRITFPGLHELVRHYTNASDGLCTRLSRPCQTQK
PQKPWWEDEWEVPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAE
ANLMKQLQHQRLVRLYAVVTQEPIYIITEYMENDTLLDSQLEEKGLGASPWGNLGQQLLL
LPTGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSC
KIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGR
IPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMRLCWKERPEDRPTFDYLRSVLEDFF
TATEGQYQPQP

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu