LOADING...
   BC011707;KN.B21268A.NRBF2
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BC011707 Chemical properties of protein sequence with tag

Accession: BC011707
Description: BC011707 Homo sapiens nuclear receptor binding factor 2, mRNA (cDNA clone MGC:19778 IMAGE:3687848), complete cds, coding region:99-962
Organism: HOMO SAPIENS
  No Tag Tag
Residues(aa) 287 299
Molecular Weight (Dalton) 32375.93 33830.48
Isoelectric Point 5.61 5.98
Extinction Coefficient 22460 22460
Gravy -.76 -0.80
Number of Met 6 7
%Met 2.09 2.34
Number of Cys 3 3
%Cys 1.05 1.00
SEQUENCE  amino acids 299 aa; containing Tag mgsdkihhhhhh
>BC011707 BC011707 Homo sapiens nuclear receptor binding factor 2, mRNA (cDNA clone MGC:19778 IMAGE:3687848), complete cds, coding region:99-962
mgsdkihhhhhhMEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLT
QSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAED
AEGQSPLSQKYSPSTEKCLPEIQGIFDRDPDTLLYLLQQKSEPAEPCIGSKAPKDDKTII
EEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELW
SLPPHAETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMNN

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu