LOADING...
   BC011564;RF20603A.DAX1
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BC011564 Chemical properties of protein sequence with tag

Accession: BC011564
Description: BC011564 Homo sapiens nuclear receptor subfamily 0, group B, member 1, mRNA (cDNA clone MGC:20161 IMAGE:4637694), complete cds, coding region:13-1425
Organism: HOMO SAPIENS
  No Tag Tag
Residues(aa) 470 482
Molecular Weight (Dalton) 51714.84 53169.39
Isoelectric Point 8.47 8.47
Extinction Coefficient 74370 74370
Gravy -.18 -0.22
Number of Met 11 12
%Met 2.34 2.49
Number of Cys 23 23
%Cys 4.89 4.77
SEQUENCE  amino acids 482 aa; containing Tag mgsdkihhhhhh
>BC011564 BC011564 Homo sapiens nuclear receptor subfamily 0, group B, member 1, mRNA (cDNA clone MGC:20161 IMAGE:4637694), complete cds, coding region:13-1425
mgsdkihhhhhhMAGENHQWQGSILYNMLMSAKQTRAAPEAPETRLVDQCWGCSCGDEPG
VGREGLLGGRNVALLYRCCFCGKDHPRQGSILYSMLTSAKQTYAAPKAPEATLGPCWGCS
CGSDPGVGRAGLPGGRPVALLYRCCFCGEDHPRQGSILYSLLTSSKQTHVAPAAPEARPG
GAWWDRSYFAQRPGGKEALPGGRATALLYRCCFCGEDHPQQGSTLYCVPTSTNQAQAAPE
ERPRAPWWDTSSGALRPVALKSPQVVCEAASAGLLKTLRFVKYLPCFQVLPLDQQLVLVR
NCWASLLMLELAQDRLQFETVEVSEPSMLQKILTTRRRETGGNEPLPVPTLQHHLAPPAE
ARKVPSASQVQAIKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQ
QILSEHTRMTHQGPHDRFIELNSTLFLLRFINANVIAELFFRPIIGTVSMDDMMLEMLCT
KI

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu