LOADING...
   AF124247;AF124247
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
AF124247 Chemical properties of protein sequence with tag

Accession: AF124247
Description: AF124247 Homo sapiens hepatocytic transcription factor hB1F-2 (B1F2) mRNA, complete cds, coding region:1-1623
Organism: HOMO SAPIENS
  No Tag Tag
Residues(aa) 541 553
Molecular Weight (Dalton) 61328.25 62782.80
Isoelectric Point 8.08 8.09
Extinction Coefficient 46760 46760
Gravy -.4 -0.43
Number of Met 22 23
%Met 4.07 4.16
Number of Cys 14 14
%Cys 2.59 2.53
SEQUENCE  amino acids 553 aa; containing Tag mgsdkihhhhhh
>AF124247 AF124247 Homo sapiens hepatocytic transcription factor hB1F-2 (B1F2) mRNA, complete cds, coding region:1-1623
mgsdkihhhhhhMSSNSDTGDLQESLKHGLTPIGAGLPDRHGSPIPARGRLVMLPKVETE
ALGLARSHGEQGQMPENMQVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKG
FFKRTVQNNKRYTCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKF
GPMYKRDRALKQQKKALIRANGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHA
ALPPTDYDRSPFVTSPISMTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYS
YMDSYQTSSPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKM
ADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTG
QQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQ
LVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPY
NNLLIEMLHAKRA

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu