LOADING...
   13422365;PC07372D
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
13422365 Chemical properties of protein sequence with tag

Accession: 13422365
Description: gi|13422365|gb|AAK23049.1| hypothetical protein [Caulobacter crescentus]
Organism: CAULOBACTER CRESCENTUS
  No Tag Tag
Residues(aa) 109 121
Molecular Weight (Dalton) 12188.04 13642.59
Isoelectric Point 5.02 5.95
Extinction Coefficient 17990 17990
Gravy -.31 -0.43
Number of Met 2 3
%Met 1.83 2.48
Number of Cys 0 0
%Cys 0.00 0.00
SEQUENCE  amino acids 121 aa; containing Tag mgsdkihhhhhh
>13422365 gi|13422365|gb|AAK23049.1| hypothetical protein [Caulobacter crescentus]
mgsdkihhhhhhMLLSTDIWVAALIRRAELGGAFATVARKGDARAGAVLVKAVDRREGTA
RLFSEATRGDGERFWMQPVRSTFEPDLDAYAERAARIDPDIWVVEIEDRDGRHFLTEPVE
S

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu