LOADING...
   104161995;ME9797A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
104161995 Chemical properties of protein sequence with tag

Accession: 104161995
Description: gi|104161995|emb|CAJ75704.1| predicted HD superfamily hydrolase [uncultured Thermotogales bacterium]
Organism: uncultured Thermotogales bacterium
  No Tag Tag
Residues(aa) 219 231
Molecular Weight (Dalton) 24633.54 26088.09
Isoelectric Point 6.36 6.59
Extinction Coefficient 19940 19940
Gravy -.29 -0.37
Number of Met 5 6
%Met 2.28 2.60
Number of Cys 1 1
%Cys 0.46 0.43
SEQUENCE  amino acids 231 aa; containing Tag mgsdkihhhhhh
>104161995 gi|104161995|emb|CAJ75704.1| predicted HD superfamily hydrolase [uncultured Thermotogales bacterium]
mgsdkihhhhhhMNLTELMERIPHLREILNIVREAFKDYDDPAHDISHTFRVMENASEIA
SREKCDLQKAIIAALLHDIKRPHEALTGVDHAESGAEYASGLLPTMGFDISFVAEVSKAI
RSHRYSGGLTPTSLTGKILQDADRLDAIGAVAIARVFSYSGKTGTPLHSLQFSPRSSYSG
NSRSSINHFHEKILKIRPETFWTETARKMAEDRYSFVVEFVQRFLAEWGQI

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu