LOADING...
   ZP_02072838.1;SP13297C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02072838.1    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>ZP_02072838.1 gi|160891835|ref|ZP_02072838.1| hypothetical protein BACUNI_04292 [Bacteroides uniformis ATCC 8492]
     1 MKKRVIFLLTGLFIWTSVLLAQNVPEGVIGAFKEGNSQELNKYLGDKVDLIIQNKSTHAD     60
       ----EEEEE---HHHHHHHHH------EEEE------HHHHHH----EEEEEE-------       
    61 KRTAEGTMAAFFSNHKVGSFNVNHQGKRDESGFVIGILMTANGNFRVNCFFRKVQNKYVI    120
       ----HHHHHHHH--------------------EEEEEEEE-----EEEHHHHHH--EEEE       
   121 HQIRIDKTDE                                                      130
       EEEEE-----       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu