LOADING...
   ZP_02069929.1;SP13538A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02069929.1    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>ZP_02069929.1 gi|160888926|ref|ZP_02069929.1| hypothetical protein BACUNI_01346 [Bacteroides uniformis ATCC 8492]
     1 MMKLHLKYLWIVLVACTLTACMNGGGDLAGKWQLRQYQYADGTSEKVDSVFYNFQKGSFS     60
       ----HHHHHHHHHHHHHHHH--------HHHHHHHHHHH------EEEEEEEE------E       
    61 AICLLKDGGLTTFFGNYSLKGAEISIILLPESVNDKNYDTYFGWPEGKCTFKVEDLSYSS    120
       EEEEE-----EEEE-------EEEEEEE---------------------EEEE-----HH       
   121 LRLEYEGTKSIFRKF                                                 135
       HHHHHH---E-----       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu