LOADING...
   ZP_02066560.1;SP8524C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02066560.1    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>ZP_02066560.1 gi|160885557|ref|ZP_02066560.1| hypothetical protein BACOVA_03559 [Bacteroides ovatus ATCC 8483]
     1 MMNKHIFYYLMVGSMALLLGACNDSMNDLLEPKVYFESKEYNFSVEDEMDVMTFDLVSRL     60
       -----EEEEHHHHHHHHHH--------------EEE--------------EEEEEEEE--       
    61 SSATSSQVDVSYSVAEPSVVDEYNAKYGTNYEMLDVSQVKLSSTTSSISSGKLYADNIEV    120
       ------EEEEEEEE----EEEE--------EEEEEEEEEEE----------HHHHHHHHH       
   121 ELSGLEALKAGNSYVLPMRVHSSSVSTLSGTNIAYFFFSKPLKITKAGNFSNHYISVKFP    180
       HHHHHHHHHH---EEEEEEE-----EE-----EEEEEE-----EE-------EEEEEEE-       
   181 VGTFFSSFTYEALINVDYFLDNNTIMGTEGVMILRIGDAGGGITPKDYLEVAGGQNYRVT    240
       --EE---HHHHHHHHHHHH-----EE---EEEEEEE-----------EEEE-----EEEE       
   241 KPLLTNRWYHVALTYDQPTGKTGIYVNGEKWAGSDWGIDGFDPNSDMGFYIGRIYGFKWG    300
       --------EEEEEE-------EEEEEE---------------------EEEEEE------       
   301 ERPFHGKMSEVRVWSVARTENQLKQNMLGVDPASEGLALYYKLDGSETQEGGVIKDATGR    360
       --------EEEEEEEHHHHHHHHHHHH------HHHHHHHHH---------EEEEE----       
   361 INGTTNGITIKTLDAPIAIN                                            380
       E------EEEEE--------       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu