LOADING...
   ZP_02043836.1;SP17439A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02043836.1    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>ZP_02043836.1 gi|154508194|ref|ZP_02043836.1| hypothetical protein ACTODO_00688 [Actinomyces odontolyticus ATCC 17982]
     1 MKKGVAALGALSLTSALLMSACGGGTSTQGSESSSGGDASGSYDVSSQSITFIPKQLNNP     60
       ----HHHHHHHHHHHHHHHH-----------------------E-----EEEE-------       
    61 FSDVMLGGGKNAAGEIGFAEVNVVGPLEASSSSQVSFINSEVQAGTNVLVIAANDPDAVC    120
       --EEE---------HHHEEEEEEE----------EEEEEEEE----EEEEEE--------       
   121 PALQDARKAGTKVVTFDSDSAADCRDLFINQVESKQVAITMLDMVSDQIGGSGKVAILSA    180
       HHHHHHHH---EEEEE-------HHHHHHHHHHHHHHHHHHHHHH--------EEEEEHH       
   181 TANAANQNAWIKFMEDEIASNDKYKGIEIVAKVYGDDDDTKSFQEAQGLLQAHPDLNAIV    240
       HHHHHHHHHHHHHHHHHH--------EEEEEEEE------HHHHHHHHHHH-------EE       
   241 SPTTVGIAATARYLSTSDYKGKVFLTGLGLPNEMRSFVKDGTVKEFALWDPAQLGYVAAY    300
       ---EEHHHHHHHH--------EEEEE---------EEE----EEEEE----HHHHHHHHH       
   301 AGAALDSGAIKGEVGEKFTAGNLGERTIGENKTVVVGDPVRFNADNIDKYDF            352
       HHHHHHH----------E--------EE---EEEEEE---------------       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu