LOADING...
   ZP_02032405.1;SP13677A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02032405.1    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>ZP_02032405.1 gi|154492779|ref|ZP_02032405.1| hypothetical protein PARMER_02418 [Parabacteroides merdae ATCC 43184]
     1 MRHLHFGKLFFVVFSLLLAYTVSARKPIKTLLITGQNNHNWQVSHVVLKQILENSGRFDV     60
       ---------HHHHHHHHHHHHHH-----EEEEEE-------EEEEEEEEEEE-------E       
    61 DFVISPEQGKDMSGFVLDFSPYQLVVLDYNGDSWPEETNRRFLEYVQNGGGVVIYHAADN    120
       EEEE----------EEE-----EEEEEE-----------EEEEEEEE---EEEEEEE---       
   121 AFSKWPEFNRICALGGWEGRNENSGPYVYWKDGKLVKDSSAGPGGSHGRQHEYVLNGRDK    180
       --------EEEEE-------------EEEEE---EEE-------------EEEEE-----       
   181 VHPVVKGLPLKWRHAKDELYDRMRGPGNIRDILYTAYSDKETNGSGREEPLVFTVDYGNA    240
       --EEEE----HHHHHHHHHHHH-------EEEEEEE--------------EEEEE----E       
   241 RIFHTMLGHAGATTEDNIAMQCTGFQVLLLRGAEWAATGKVTQKVPKDFPTETTCSYRKD    300
       EEEEEE---------HHHHHHHHHHHHHHHHHHHHHH----EEE---------E------       
   301 YKEN                                                            304
       ----       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu