LOADING...
   ZP_02030716.1;SP16962B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02030716.1    Secondary Structure Prediction




   Transmembrane helix      alpha-helix      beta-strand    

Secondary Structure Map

>ZP_02030716.1 gi|154490775|ref|ZP_02030716.1| hypothetical protein PARMER_00689 [Parabacteroides merdae ATCC 43184]
     1 MKNSRRDFLKKGALAGFSALMIPEIAKAAVKENTSVHAPKINLKKDCVILFQGDSITDCG     60
       -----HHHHHHHHHHHHHHHHHHHHHHHHHHH--------------EEEEEE--------       
    61 RDRNSNRCNTMEQFGSGYVLFTATQLLEGKAALQPKIYNRGISGNKVYQLRERWEIDCLA    120
       ----------EE-----EEEEHHHHHHHHHHHH------------HHHHHHHHHHHHHH-       
   121 FQPDVLSILIGVNDYWHTLTHGYKGTVETYENDLRALLKYTKEKLPNTQIVLCEPFTLRD    180
       ----EEEEEEE---EEEEEE------EEEHHHHHHHHHHHHH------EEEEE-------       
   181 GAAIEDSKWYPMFDEFRKSARKLSEEFNTIFVPFQSGFDAAVKLAPARYWSNDGVHPDLP    240
       --------------HHHHHHHHHHH---EEEE------HHHHHH----------------       
   241 GRQLMANMWMEATGLK                                                256
       -HHHHHHHHHHH----       

Secondary structure: H - alpha helix, E - beta strand

Notes
Secondary structure prediction is done using JNET: A Neural Network Protein Secondary Structure Prediction Method.
Contact Webmaster JCSG Menu